PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00002.1.g07190.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 569aa    MW: 60345 Da    PI: 4.7447
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00002.1.g07190.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.71.2e-901255211373
                          GRAS   1 lvelLlecAeavss..gdlelaqalLarlselaspdgd......pmqRlaayfteALaarlarsvselykal...ppsets 70 
                                   l +lL+++Aea+s   ++ ela+ +L rl+e++s +g+      +m+Rlaa+ft AL+  l +s +  ++     ++++++
  Zjn_sc00002.1.g07190.1.sm.mk 125 LLHLLMAAAEALSGphKSWELARVILVRLKEMVSHTGStnaaasNMERLAAHFTDALQGLLDGSHPVGAAGRqaaAAQQQQ 205
                                   579**********8446667************9999966888889*****************9766544333111444444 PP

                          GRAS  71 eknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgs 149
                                   ++++ ++l+a++l++++sP++kf+h+taNqaIleav+g++rvHi+D+di +G+QW++L+qa+ s p   +pp+lRiT++++
  Zjn_sc00002.1.g07190.1.sm.mk 206 HHHTGDVLTAFQLLQDMSPYMKFGHFTANQAILEAVAGDRRVHIVDYDIAEGVQWASLMQAMISCPdgVPPPHLRITALSR 286
                                   455999**********************************************************99777799********* PP

                          GRAS 150 pesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLkl 230
                                   +  g +++++e+g+rLa fA+++g pf+f     ++ + ++  + r+ +gE l+ n+vl+          ++    ++L  
  Zjn_sc00002.1.g07190.1.sm.mk 287 SGGGGSRAVQEVGRRLAAFAASIGQPFSFGQCRLDSEDRFRAATVRMVKGEILVANCVLNQAAATTTIRRSTGSVASFLAG 367
                                   7777***************************99999999********************887777555555557889**** PP

                          GRAS 231 vkslsPkvvvvveqeadh.nse..........sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                                   + +l +kvv+vve++    ++e           F++rf+e l+ ysa+ dslea++p++s+ r  vEr++l+++i  +++ 
  Zjn_sc00002.1.g07190.1.sm.mk 368 MATLGAKVVTVVEEDQGDaEKEdeesgdaaagGFVTRFMEELHRYSAVWDSLEAGFPTQSRVRGLVERVILAPNIAGALSR 448
                                   **************944423335688899999************************************************* PP

                          GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees.gslvlgWkdrpLvsvSaW 373
                                   + ++     e ++ W e+++  GF+pv ls ++ +qa+lll  ++ dgy++ee s + +vlgWk ++L+s+S+W
  Zjn_sc00002.1.g07190.1.sm.mk 449 AYRAVDGVDEAKGGWGEWMRGNGFRPVVLSCFNHSQARLLLGLFN-DGYTMEETSpNKIVLGWKAQRLLSASVW 521
                                   *********************************************.******88626777************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.03999502IPR005202Transcription factor GRAS
PfamPF035144.0E-88125521IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MDVTMDDVAG ELEFSGCSST TSSSPSCSLD AGTAMYCAWN GLAPVADWAP LCSDDGGQDL  60
HGLIESMLCD DTLDDHAGLH PAMFLDEACC YSNGSGPSST TTTNPGTPVH DVDAQGDCPE  120
KGLRLLHLLM AAAEALSGPH KSWELARVIL VRLKEMVSHT GSTNAAASNM ERLAAHFTDA  180
LQGLLDGSHP VGAAGRQAAA AQQQQHHHTG DVLTAFQLLQ DMSPYMKFGH FTANQAILEA  240
VAGDRRVHIV DYDIAEGVQW ASLMQAMISC PDGVPPPHLR ITALSRSGGG GSRAVQEVGR  300
RLAAFAASIG QPFSFGQCRL DSEDRFRAAT VRMVKGEILV ANCVLNQAAA TTTIRRSTGS  360
VASFLAGMAT LGAKVVTVVE EDQGDAEKED EESGDAAAGG FVTRFMEELH RYSAVWDSLE  420
AGFPTQSRVR GLVERVILAP NIAGALSRAY RAVDGVDEAK GGWGEWMRGN GFRPVVLSCF  480
NHSQARLLLG LFNDGYTMEE TSPNKIVLGW KAQRLLSASV WAPPPMLVPP SPPEGVLQSG  540
GMAPVSGGVG RIEFDYIDSF LVEPAYAIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3315552125374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008653941.10.0PREDICTED: nodulation-signaling pathway 2 protein-like
SwissprotQ5NE241e-152NSP2_MEDTR; Nodulation-signaling pathway 2 protein
TrEMBLA0A060CZR10.0A0A060CZR1_MAIZE; GRAS transcription factor (Fragment)
STRINGGRMZM2G055263_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75803148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-106GRAS family protein